SCOP 1.67: Domain d1efua2: 1efu A:297-393

Lineage for d1efua2 (1efu A:297-393)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (4 PDB entries)

8. Domain d1efua2: 1efu A:297-393 [25722]
   Other proteins in same PDB: d1efua1, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc3, d1efud2, d1efud3, d1efud4

Details for d1efua2

PDB Entry: 1efu, 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efua2:

Sequence; same for both SEQRES and ATOM records:

>d1efua2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d1efua2:

• d1efua2 first appeared (with stable ids) in SCOP 1.55
  
• d1efua2 appears in SCOP 1.65
  
• d1efua2 appears in SCOP 1.69
  
• d1efua2 appears in the current release, SCOPe 2.08