| Class b: All beta proteins [48724] (126 folds) |
| Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Escherichia coli [TaxId:562] [50468] (4 PDB entries) |
| Domain d1efua2: 1efu A:297-393 [25722] Other proteins in same PDB: d1efua1, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc3, d1efud2, d1efud3, d1efud4 |
PDB Entry: 1efu (more details), 2.5 Å
SCOP Domain Sequences for d1efua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efua2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls
Timeline for d1efua2: