SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4o1ta_ (4o1t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978471Protein Neuroglobin [100978] (2 species)
  7. 1978479Species Mouse (Mus musculus) [TaxId:10090] [109625] (21 PDB entries)
    Uniprot Q9ER97
  8. 1978481Domain d4o1ta_: 4o1t A: [257210]
    automated match to d1oj6b_
    complexed with hem, so4; mutant

Details for d4o1ta_

PDB Entry: 4o1t (more details), 1.6 Å

PDB Description: Crystal structure of murine neuroglobin mutant F106W
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d4o1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1ta_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlsswstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d4o1ta_:

Click to download the PDB-style file with coordinates for d4o1ta_.
(The format of our PDB-style files is described here.)

Timeline for d4o1ta_: