Class g: Small proteins [56992] (92 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187112] (13 PDB entries) |
Domain d4o1qc_: 4o1q C: [257209] automated match to d4fa9e_ complexed with ca, edo, hec, mes, na, pge, po4 |
PDB Entry: 4o1q (more details), 2.59 Å
SCOPe Domain Sequences for d4o1qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1qc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d4o1qc_: