SCOPe 2.05: Domain d4o1qc_: 4o1q C:

Lineage for d4o1qc_ (4o1q C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [187112] (13 PDB entries)

8. Domain d4o1qc_: 4o1q C: [257209]
   automated match to d4fa9e_
   complexed with ca, edo, hec, mes, na, pge, po4

Details for d4o1qc_

PDB Entry: 4o1q, 2.59 Å

PDB Description: Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4o1qc_:

Sequence; same for both SEQRES and ATOM records:

>d4o1qc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d4o1qc_:

• d4o1qc_ first appeared in SCOPe 2.04
  
• d4o1qc_ appears in SCOPe 2.06
  
• d4o1qc_ appears in the current release, SCOPe 2.08