SCOPe 2.08: Domain d4o0mb2: 4o0m B:256-501

Lineage for d4o0mb2 (4o0m B:256-501)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [257204] (1 PDB entry)

8. Domain d4o0mb2: 4o0m B:256-501 [257208]
   automated match to d1tf7a2
   complexed with atp, mg

Details for d4o0mb2

PDB Entry: 4o0m, 2.84 Å

PDB Description: Crystal structure of T. Elongatus BP-1 Clock Protein KaiC

PDB Compounds: (B:) Circadian clock protein kinase kaiC

SCOPe Domain Sequences for d4o0mb2:

Sequence; same for both SEQRES and ATOM records:

>d4o0mb2 c.37.1.0 (B:256-501) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qrssnvrvssgvktldemcgggffkdsiilatgatgtgktllvskfletgcqqgerallf
ayeesraqlsrnasswgidfeelerrgllriicaypesagledhlqiikseiadfkpsrv
aidslsalargvsnnafrqfvigvtgfakqeeitgfftnttdqfmgsnsiteshistitd
tilllqyveirgemsrainvfkmrgswhdkgireyvitekgaeirdsfrnfegiisgtpt
risvde

Timeline for d4o0mb2:

• d4o0mb2 first appeared in SCOPe 2.04
  
• d4o0mb2 appears in SCOPe 2.07