Lineage for d1ffkb_ (1ffk B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669648Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 669649Protein Ribosomal protein L3 [50462] (1 species)
    superfamily fold is elaborated with additional structures
  7. 669650Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)
  8. 669682Domain d1ffkb_: 1ffk B: [25719]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    CA-atoms only
    complexed with cd, k, mo3; mutant

Details for d1ffkb_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (B:) ribosomal protein l3

SCOP Domain Sequences for d1ffkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkb_ b.43.3.2 (B:) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhdp
daaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhaldi
vedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlgp
wnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgsv
pgpdkrlvpffrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d1ffkb_:

Click to download the PDB-style file with coordinates for d1ffkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkb_: