SCOPe 2.05: Domain d4nsya_: 4nsy A:

Lineage for d4nsya_ (4nsy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (4 species)
   not a true protein

7. Species Lysobacter enzymogenes [TaxId:69] [189631] (4 PDB entries)

8. Domain d4nsya_: 4nsy A: [257189]
   automated match to d1arba_
   complexed with 2oy, ca, cl

Details for d4nsya_

PDB Entry: 4nsy, 1.1 Å

PDB Description: wild-type lysobacter enzymogenes lysc endoproteinase covalently inhibited by tlck

PDB Compounds: (A:) Lysyl endopeptidase

SCOPe Domain Sequences for d4nsya_:

Sequence; same for both SEQRES and ATOM records:

>d4nsya_ b.47.1.1 (A:) automated matches {Lysobacter enzymogenes [TaxId: 69]}
gvsgscnidvvcpegnghrdvirsvaayskqgtmwctgslvnnsandkkmyfltanhcgm
ttaaiassmvvywnyqnstcrapgssssgangdgslaqsqtgavvratnaasdftlleln
taanpaynlfwagwdrrdqnfagataihhpnvaekrishstvateisgyngatgtshlhv
fwqasggvtepgssgspiyspekrvlgqlhggpsscsatgadrsdyygrvftswtgggts
atrlsdwldaagtgaqfidgldst

Timeline for d4nsya_:

• d4nsya_ first appeared in SCOPe 2.04
  
• d4nsya_ appears in SCOPe 2.06
  
• d4nsya_ appears in the current release, SCOPe 2.08