![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (431 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d4nqdf_: 4nqd F: [257185] Other proteins in same PDB: d4nqda1, d4nqda2, d4nqdc1, d4nqdc2, d4nqdd1, d4nqde1, d4nqde2, d4nqdg1, d4nqdg2, d4nqdh1, d4nqdh2 automated match to d1xh3b_ complexed with 2lj, gol |
PDB Entry: 4nqd (more details), 2.2 Å
SCOPe Domain Sequences for d4nqdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqdf_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d4nqdf_: