SCOPe 2.06: Domain d4nqcd2: 4nqc D:111-198

Lineage for d4nqcd2 (4nqc D:111-198)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4nqcd2: 4nqc D:111-198 [257180]
   Other proteins in same PDB: d4nqca1, d4nqca2, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc2, d4nqcc3, d4nqcd1, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqch1, d4nqch2
   automated match to d2f54d2
   complexed with 2lj, na

Details for d4nqcd2

PDB Entry: 4nqc, 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d4nqcd2:

Sequence, based on SEQRES records:

>d4nqcd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d4nqcd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnac
anafnnsiipedtffp

Timeline for d4nqcd2:

• d4nqcd2 first appeared in SCOPe 2.04
  
• d4nqcd2 appears in SCOPe 2.05
  
• d4nqcd2 appears in SCOPe 2.07
  
• d4nqcd2 appears in the current release, SCOPe 2.08