Lineage for d4nqcd2 (4nqc D:111-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750785Domain d4nqcd2: 4nqc D:111-198 [257180]
    Other proteins in same PDB: d4nqca1, d4nqca2, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc2, d4nqcc3, d4nqcd1, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqch1, d4nqch2
    automated match to d2f54d2
    complexed with 2lj, na

Details for d4nqcd2

PDB Entry: 4nqc (more details), 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil
PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d4nqcd2:

Sequence, based on SEQRES records: (download)

>d4nqcd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4nqcd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnac
anafnnsiipedtffp

SCOPe Domain Coordinates for d4nqcd2:

Click to download the PDB-style file with coordinates for d4nqcd2.
(The format of our PDB-style files is described here.)

Timeline for d4nqcd2: