SCOPe 2.08: Domain d4nqcd1: 4nqc D:2-110

Lineage for d4nqcd1 (4nqc D:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4nqcd1: 4nqc D:2-110 [257179]
   Other proteins in same PDB: d4nqca1, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc3, d4nqcd2, d4nqcf_, d4nqcg2
   automated match to d2f54d1
   complexed with 2lj, na

Details for d4nqcd1

PDB Entry: 4nqc, 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d4nqcd1:

Sequence; same for both SEQRES and ATOM records:

>d4nqcd1 b.1.1.0 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d4nqcd1:

• d4nqcd1 first appeared in SCOPe 2.04
  
• d4nqcd1 appears in SCOPe 2.07