Lineage for d4nqca1 (4nqc A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938776Domain d4nqca1: 4nqc A:1-178 [257176]
    Other proteins in same PDB: d4nqca2, d4nqca3, d4nqcb_, d4nqcc2, d4nqcc3, d4nqcd1, d4nqcd2, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqcg2, d4nqch1, d4nqch2
    automated match to d4l4ta1
    complexed with 2lj, na

Details for d4nqca1

PDB Entry: 4nqc (more details), 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4nqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4nqca1:

Click to download the PDB-style file with coordinates for d4nqca1.
(The format of our PDB-style files is described here.)

Timeline for d4nqca1: