| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d4nqca1: 4nqc A:1-178 [257176] Other proteins in same PDB: d4nqca2, d4nqca3, d4nqcb_, d4nqcc2, d4nqcc3, d4nqcd1, d4nqcd2, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqcg2, d4nqch1, d4nqch2 automated match to d4l4ta1 complexed with 2lj, na |
PDB Entry: 4nqc (more details), 2.5 Å
SCOPe Domain Sequences for d4nqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4nqca1: