Lineage for d4nnjb_ (4nnj B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638525Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (3 PDB entries)
  8. 1638526Domain d4nnjb_: 4nnj B: [257173]
    automated match to d3dbhi_
    complexed with amp, gol, so4

Details for d4nnjb_

PDB Entry: 4nnj (more details), 2.4 Å

PDB Description: Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin
PDB Compounds: (B:) Uba1

SCOPe Domain Sequences for d4nnjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnjb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aamqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsd
yniqkestlhlvlrlrgg

SCOPe Domain Coordinates for d4nnjb_:

Click to download the PDB-style file with coordinates for d4nnjb_.
(The format of our PDB-style files is described here.)

Timeline for d4nnjb_: