SCOPe 2.06: Domain d4nl5a_: 4nl5 A:

Lineage for d4nl5a_ (4nl5 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries)

8. Domain d4nl5a_: 4nl5 A: [257171]
   automated match to d3hx9a_
   complexed with act, cyn, hem

Details for d4nl5a_

PDB Entry: 4nl5, 1.9 Å

PDB Description: Mycobacterium tuberculosis heme-degrading protein MhuD in complex with heme and cyanide

PDB Compounds: (A:) Heme-degrading monooxygenase HmoB

SCOPe Domain Sequences for d4nl5a_:

Sequence; same for both SEQRES and ATOM records:

>d4nl5a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvggtg

Timeline for d4nl5a_:

• d4nl5a_ first appeared in SCOPe 2.04
  
• d4nl5a_ appears in SCOPe 2.05
  
• d4nl5a_ appears in SCOPe 2.07
  
• d4nl5a_ appears in the current release, SCOPe 2.08