Lineage for d4nl1a_ (4nl1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840322Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2840323Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2840324Protein Dihydropteroate synthetase [51719] (5 species)
  7. 2840325Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
    Uniprot Q81VW8
  8. 2840364Domain d4nl1a_: 4nl1 A: [257169]
    automated match to d1tx2a_
    complexed with so4, z13

Details for d4nl1a_

PDB Entry: 4nl1 (more details), 2.3 Å

PDB Description: crystal structure of b. anthracis dhps with compound 11: (e)-n-[4- (trifluoromethyl)benzyl]-1-[4-(trifluoromethyl)phenyl]methanimine
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d4nl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nl1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d4nl1a_:

Click to download the PDB-style file with coordinates for d4nl1a_.
(The format of our PDB-style files is described here.)

Timeline for d4nl1a_: