SCOPe 2.06: Domain d4nira1: 4nir A:2-274

Lineage for d4nira1 (4nir A:2-274)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein Dihydropteroate synthetase [51719] (5 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
   Uniprot Q81VW8

8. Domain d4nira1: 4nir A:2-274 [257167]
   Other proteins in same PDB: d4nira2, d4nirb2
   automated match to d1tx2a_
   complexed with 6dh, so4

Details for d4nira1

PDB Entry: 4nir, 1.77 Å

PDB Description: crystal structure of b. anthracis dhps with compound 6: 3-[6- (trifluoromethyl)-1h-benzimidazol-2-yl]propan-1-ol

PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d4nira1:

Sequence; same for both SEQRES and ATOM records:

>d4nira1 c.1.21.1 (A:2-274) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Timeline for d4nira1:

• d4nira1 first appeared in SCOPe 2.04, called d4nira_
  
• d4nira1 was called d4nira_ in SCOPe 2.05
  
• d4nira1 appears in SCOPe 2.07
  
• d4nira1 appears in the current release, SCOPe 2.08