Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein Dihydropteroate synthetase [51719] (5 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries) Uniprot Q81VW8 |
Domain d4nira1: 4nir A:2-274 [257167] Other proteins in same PDB: d4nira2, d4nirb2 automated match to d1tx2a_ complexed with 6dh, so4 |
PDB Entry: 4nir (more details), 1.77 Å
SCOPe Domain Sequences for d4nira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nira1 c.1.21.1 (A:2-274) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat vclgiekgcefvrvhdvkemsrmakmmdamigk
Timeline for d4nira1: