Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
Protein automated matches [191077] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [313153] (4 PDB entries) |
Domain d4niia_: 4nii A: [257164] automated match to d3khca_ protein/DNA complex; protein/RNA complex; complexed with akg, mn; mutant |
PDB Entry: 4nii (more details), 1.62 Å
SCOPe Domain Sequences for d4niia_:
Sequence, based on SEQRES records: (download)
>d4niia_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]} qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclh qdkiepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqp lkagfhpltidcrynltfrqagk
>d4niia_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]} qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclh qdkilrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka gfhpltidcrynltfrqagk
Timeline for d4niia_: