SCOPe 2.08: Domain d4niia_: 4nii A:

Lineage for d4niia_ (4nii A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein automated matches [191077] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [313153] (4 PDB entries)

8. Domain d4niia_: 4nii A: [257164]
   automated match to d3khca_
   protein/DNA complex; protein/RNA complex; complexed with akg, mn; mutant

Details for d4niia_

PDB Entry: 4nii, 1.62 Å

PDB Description: Crystal structure of AlkB D135I mutant protein with cofactors bound to dsDNA containing m6A/A

PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4niia_:

Sequence, based on SEQRES records:

>d4niia_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt
hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclh
qdkiepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqp
lkagfhpltidcrynltfrqagk

Sequence, based on observed residues (ATOM records):

>d4niia_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt
hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclh
qdkilrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

Timeline for d4niia_:

• d4niia_ first appeared in SCOPe 2.04
  
• d4niia_ appears in SCOPe 2.07