| Class b: All beta proteins [48724] (178 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
| Protein automated matches [191077] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [313153] (4 PDB entries) |
| Domain d4niga_: 4nig A: [257162] automated match to d3khca_ protein/DNA complex; protein/RNA complex; complexed with akg, mn; mutant |
PDB Entry: 4nig (more details), 1.52 Å
SCOPe Domain Sequences for d4niga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4niga_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkihpdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagk
Timeline for d4niga_: