SCOPe 2.05: Domain d4nhva_: 4nhv A:

Lineage for d4nhva_ (4nhv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein Dihydropteroate synthetase [51719] (4 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (32 PDB entries)
   Uniprot Q81VW8

8. Domain d4nhva_: 4nhv A: [257158]
   automated match to d1tx2a_
   complexed with 2o6, so4

Details for d4nhva_

PDB Entry: 4nhv, 1.99 Å

PDB Description: crystal structure of b. anthracis dhps with interfacial compound 4: 5- (trifluoromethyl)-1,2-benzoxazol-3-amine

PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d4nhva_:

Sequence; same for both SEQRES and ATOM records:

>d4nhva_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii
diggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiin
diwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrden
iildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtga
tvclgiekgcefvrvhdvkemsrmakmmdamigk

Timeline for d4nhva_:

• d4nhva_ first appeared in SCOPe 2.04
  
• d4nhva_ is called d4nhva1 in SCOPe 2.06
  
• d4nhva_ appears in the current release, SCOPe 2.08, called d4nhva1