Lineage for d1g7ta2 (1g7t A:460-586)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386038Family b.43.3.1: Elongation factors [50448] (11 protein domains)
  6. 2386198Protein Initiation factor IF2/eIF5b, domains 2 and 4 [50458] (2 species)
    the C-terminal domain 4 has the same fold as domain 2; it probably binds fMet-tRNAfmet
  7. 2386201Species Methanobacterium thermoautotrophicum [TaxId:145262] [50459] (3 PDB entries)
  8. 2386205Domain d1g7ta2: 1g7t A:460-586 [25715]
    Other proteins in same PDB: d1g7ta3, d1g7ta4
    complexed with gnp, mg

Details for d1g7ta2

PDB Entry: 1g7t (more details), 2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b complexed with gdpnp
PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7ta2:

Sequence, based on SEQRES records: (download)

>d1g7ta2 b.43.3.1 (A:460-586) Initiation factor IF2/eIF5b, domains 2 and 4 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikpasirlipklvfrqskpaiggvevltgvirqgyplmnddgetvgtvesmqdkgenlk
sasrgqkvamaikdavygktihegdtlyvdipenhyhilkeqlsgdltdeeldlmdkiae
ikrkknp

Sequence, based on observed residues (ATOM records): (download)

>d1g7ta2 b.43.3.1 (A:460-586) Initiation factor IF2/eIF5b, domains 2 and 4 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikpasirlipklvfrqskpaiggvevltgvirqgyplmnddgetvgtvesmqdkgenlk
sasrgqkvamaikdavygktihegdtlyvdipenhyhilltdeeldlmdkiaeikrkknp

SCOPe Domain Coordinates for d1g7ta2:

Click to download the PDB-style file with coordinates for d1g7ta2.
(The format of our PDB-style files is described here.)

Timeline for d1g7ta2: