Lineage for d4nesa_ (4nes A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142567Species Methanocaldococcus jannaschii [TaxId:243232] [257139] (2 PDB entries)
  8. 2142568Domain d4nesa_: 4nes A: [257141]
    automated match to d4hwga_
    complexed with ud1, udp

Details for d4nesa_

PDB Entry: 4nes (more details), 1.42 Å

PDB Description: crystal structure of methanocaldococcus jannaschii udp-glcnac 2- epimerase in complex with udp-glcnac and udp
PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d4nesa_:

Sequence, based on SEQRES records: (download)

>d4nesa_ c.87.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mklsiilgtrpeiiklspiiralektnidwhiihtnqhysenmdkiffeelnlpnpkynl
nigsgthgeqtgkmlieiekvllkekpdvvvvqgdtntvlagalvasklkidvahveagl
rsfdrnmpeeinrvltdhissylfapteiaknnllregieenkifvvgntivdatlqnlk
iaeknenvraffnsvvidddyflltlhraenvdnkerlknivegifeiieiydkaiifsi
hprtkkrlkefnlfdklksnkkikiiepvgyleflmleknaeliltdsggvqeeacilkv
pcitlrdnterpetvevganilvgdnkeklikaveimlnkkrnwknpfgngksgerivri
ltyg

Sequence, based on observed residues (ATOM records): (download)

>d4nesa_ c.87.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mklsiilgtrpeiiklspiiralektnidwhiihtnqhysenmdkiffeelnlpnpkynl
nigsgthgeqtgkmlieiekvllkekpdvvvvqgdtntvlagalvasklkidvahveagl
rsfdrnmpeeinrvltdhissylfapteiaknnllregieenkifvvgntivdatlqnlk
iaeknenvraffnsvvddyflltlhraenvdnkerlknivegifeiieiydkaiifsihp
rtkkrlkefnlfdklksnkkikiiepvgyleflmleknaeliltdsggvqeeacilkvpc
itlrdnterpetvevganilvgdnkeklikaveimlnkkrnwknpfgngksgerivrilt
yg

SCOPe Domain Coordinates for d4nesa_:

Click to download the PDB-style file with coordinates for d4nesa_.
(The format of our PDB-style files is described here.)

Timeline for d4nesa_: