Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (15 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [257133] (2 PDB entries) |
Domain d4nafb_: 4naf B: [257137] automated match to d1viza_ |
PDB Entry: 4naf (more details), 1.9 Å
SCOPe Domain Sequences for d4nafb_:
Sequence, based on SEQRES records: (download)
>d4nafb_ c.1.4.1 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} eeirawrhvfkldpnkpidderlerlcesgtdavivggtdgvtidnvldllarirrfsvp calevtdvealtpgfdvylvpivlnsrqaewiigrhheavkqygdmmnwdeiaaegycil npeckaakltradteldvddivayarlaehlyklpifyleysgvygdpsvvekvkqaldq tqlfygggittpeqaehmaryadtvvvgnaiydafeqalatvaavkq
>d4nafb_ c.1.4.1 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} eeirawrhvfkldpnkpidderlerlcesgtdavivgtidnvldllarirrfsvpcalev tdvealtpgfdvylvpivlnsrqaewiigrhheavkqygdmmnwdeiaaegycilnpeck aakltradteldvddivayarlaehlyklpifyleysgvygdpsvvekvkqaldqtqlfy gggittpeqaehmaryadtvvvgnaiydafeqalatvaavkq
Timeline for d4nafb_: