Lineage for d4nafa_ (4naf A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2415254Protein automated matches [190228] (19 species)
    not a true protein
  7. 2415255Species Geobacillus kaustophilus [TaxId:235909] [257133] (2 PDB entries)
  8. 2415256Domain d4nafa_: 4naf A: [257136]
    automated match to d3vzya_

Details for d4nafa_

PDB Entry: 4naf (more details), 1.9 Å

PDB Description: prcb from geobacillus kaustophilus, apo structure
PDB Compounds: (A:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d4nafa_:

Sequence, based on SEQRES records: (download)

>d4nafa_ c.1.4.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
eirawrhvfkldpnkpidderlerlcesgtdavivggtdgvtidnvldllarirrfsvpc
alevtdvealtpgfdvylvpivlnsrqaewiigrhheavkqygdmmnwdeiaaegyciln
peckaakltradteldvddivayarlaehlyklpifyleysgvygdpsvvdkvkqaldqt
qlfygggittpeqaehmaryadtvvvgnaiydafeqalatvaavkq

Sequence, based on observed residues (ATOM records): (download)

>d4nafa_ c.1.4.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
eirawrhvfkldpnkpidderlerlcesgtdavivggvtidnvldllarirrfsvpcale
vtdvealtpgfdvylvpivlnsrqaewiigrhheavkqygdmmnwdeiaaegycilnpec
kaakltradteldvddivayarlaehlyklpifyleysgvygdpsvvdkvkqaldqtqlf
ygggittpeqaehmaryadtvvvgnaiydafeqalatvaavkq

SCOPe Domain Coordinates for d4nafa_:

Click to download the PDB-style file with coordinates for d4nafa_.
(The format of our PDB-style files is described here.)

Timeline for d4nafa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4nafb_