![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
![]() | Domain d4n7ia1: 4n7i A:298-483 [257132] Other proteins in same PDB: d4n7ia2 automated match to d2fbed_ complexed with bme, cl, gol, mg |
PDB Entry: 4n7i (more details), 1.4 Å
SCOPe Domain Sequences for d4n7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7ia1 b.29.1.0 (A:298-483) automated matches {Human (Homo sapiens) [TaxId: 9606]} aynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvlgc esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta lticpa
Timeline for d4n7ia1: