SCOPe 2.08: Domain d4n7ia1: 4n7i A:298-483

Lineage for d4n7ia1 (4n7i A:298-483)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d4n7ia1: 4n7i A:298-483 [257132]
   Other proteins in same PDB: d4n7ia2
   automated match to d2fbed_
   complexed with bme, cl, gol, mg

Details for d4n7ia1

PDB Entry: 4n7i, 1.4 Å

PDB Description: Crystal Structure of Intracellular B30.2 Domain of BTN3A1

PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d4n7ia1:

Sequence; same for both SEQRES and ATOM records:

>d4n7ia1 b.29.1.0 (A:298-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvlgc
esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep
rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta
lticpa

Timeline for d4n7ia1:

• d4n7ia1 first appeared in SCOPe 2.04, called d4n7ia_
  
• d4n7ia1 appears in SCOPe 2.07