Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) |
Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
Protein automated matches [190703] (6 species) not a true protein |
Species Escherichia coli [TaxId:83334] [257130] (1 PDB entry) |
Domain d4n72a_: 4n72 A: [257131] automated match to d1dpca_ |
PDB Entry: 4n72 (more details), 2.25 Å
SCOPe Domain Sequences for d4n72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n72a_ c.43.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]} pgmlpwpkvdfskfgeieevelgriqkisganlsrnwvmiphvthfdktditeleafrkq qneeaakrkldvkitpvvfimkavaaaleqmprfnsslsedgqrltlkkyinigvavdtp nglvvpvfkdvnkkgiielsrelmtiskkardgkltagemqggcftissigglgtthfap ivnapevailgvsksamepvwngkefvprlmlpislsfdhrvidgadgarfitiinntls dirrlv
Timeline for d4n72a_: