Lineage for d4n72a_ (4n72 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130565Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2130566Protein automated matches [190703] (6 species)
    not a true protein
  7. 2130604Species Escherichia coli [TaxId:83334] [257130] (1 PDB entry)
  8. 2130605Domain d4n72a_: 4n72 A: [257131]
    automated match to d1dpca_

Details for d4n72a_

PDB Entry: 4n72 (more details), 2.25 Å

PDB Description: Catalytic domain from dihydrolipoamide acetyltransferase of pyruvate dehydrogenase from Escherichia coli
PDB Compounds: (A:) Pyruvate dehydrogenase (Dihydrolipoyltransacetylase component)

SCOPe Domain Sequences for d4n72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n72a_ c.43.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
pgmlpwpkvdfskfgeieevelgriqkisganlsrnwvmiphvthfdktditeleafrkq
qneeaakrkldvkitpvvfimkavaaaleqmprfnsslsedgqrltlkkyinigvavdtp
nglvvpvfkdvnkkgiielsrelmtiskkardgkltagemqggcftissigglgtthfap
ivnapevailgvsksamepvwngkefvprlmlpislsfdhrvidgadgarfitiinntls
dirrlv

SCOPe Domain Coordinates for d4n72a_:

Click to download the PDB-style file with coordinates for d4n72a_.
(The format of our PDB-style files is described here.)

Timeline for d4n72a_: