Lineage for d1g7sa2 (1g7s A:460-587)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054228Family b.43.3.1: Elongation factors [50448] (10 protein domains)
  6. 2054388Protein Initiation factor IF2/eIF5b, domains 2 and 4 [50458] (2 species)
    the C-terminal domain 4 has the same fold as domain 2; it probably binds fMet-tRNAfmet
  7. 2054391Species Methanobacterium thermoautotrophicum [TaxId:145262] [50459] (3 PDB entries)
  8. 2054393Domain d1g7sa2: 1g7s A:460-587 [25713]
    Other proteins in same PDB: d1g7sa3, d1g7sa4
    complexed with gdp

Details for d1g7sa2

PDB Entry: 1g7s (more details), 2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b complexed with gdp
PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7sa2:

Sequence, based on SEQRES records: (download)

>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikpasirlipklvfrqskpaiggvevltgvirqgyplmnddgetvgtvesmqdkgenlk
sasrgqkvamaikdavygktihegdtlyvdipenhyhilkeqlsgdltdeeldlmdkiae
ikrkknpd

Sequence, based on observed residues (ATOM records): (download)

>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikpasirlipklvfrqskpaiggvevltgvirqgyplmnddgetvgtvesmqdkgenlk
sasrgqkvamaikdavygktihegdtlyvdipenhyhilkeqlltdeeldlmdkiaeikr
kknpd

SCOPe Domain Coordinates for d1g7sa2:

Click to download the PDB-style file with coordinates for d1g7sa2.
(The format of our PDB-style files is described here.)

Timeline for d1g7sa2: