SCOPe 2.05: Domain d4n6fa_: 4n6f A:

Lineage for d4n6fa_ (4n6f A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.31: ThiG-like [110399] (2 families)
   shares the common phosphate-binding site with other superfamilies

5. Family c.1.31.0: automated matches [191453] (1 protein)
   not a true family

6. Protein automated matches [190693] (2 species)
   not a true protein

7. Species Amycolatopsis orientalis [TaxId:797057] [257127] (2 PDB entries)

8. Domain d4n6fa_: 4n6f A: [257129]
   automated match to d1tyga_
   complexed with ca, f6r

Details for d4n6fa_

PDB Entry: 4n6f, 2.25 Å

PDB Description: crystal structure of amycolatopsis orientalis bexx complexed with g6p

PDB Compounds: (A:) Putative thiosugar synthase

SCOPe Domain Sequences for d4n6fa_:

Sequence; same for both SEQRES and ATOM records:

>d4n6fa_ c.1.31.0 (A:) automated matches {Amycolatopsis orientalis [TaxId: 797057]}
depwlkigarefrsrilvgieqydsvplvrdvlnaagadvfittvdpdnrrsslllmdla
delplddftwigttsfartkesalrsarilrdslgieilkldvrgddntpdnagtveaar
elraegmellpfilpdlataraleeagcaalrvmaspvasgrgianpaairelieqigip
vvveggigsarhvaeamelgasatlvntalvraespllmaaamrqaalagllsyesgpmp
ev

Timeline for d4n6fa_:

• d4n6fa_ first appeared in SCOPe 2.04
  
• d4n6fa_ appears in SCOPe 2.06
  
• d4n6fa_ appears in the current release, SCOPe 2.08