Lineage for d4n4pa_ (4n4p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086802Species Mycoplasma synoviae [TaxId:262723] [257122] (2 PDB entries)
  8. 2086803Domain d4n4pa_: 4n4p A: [257123]
    automated match to d4imca_
    complexed with cl

Details for d4n4pa_

PDB Entry: 4n4p (more details), 1.8 Å

PDB Description: Crystal Structure of N-acetylneuraminate lyase from Mycoplasma synoviae, crystal form I
PDB Compounds: (A:) Acylneuraminate lyase

SCOPe Domain Sequences for d4n4pa_:

Sequence, based on SEQRES records: (download)

>d4n4pa_ c.1.10.0 (A:) automated matches {Mycoplasma synoviae [TaxId: 262723]}
mhnfdkfkglfpamvtpftkdgklhkagvkevvnflvekqkvdgiyitgstgeflllsfe
dkkevmklvaeanagrvtliaqigslnieetkelaklakelkydaisaitpyyynfsfne
thhyyeeiskaadipmliyylpqlagqkvstdqfgklleiknvigskygatdlfaferlm
skypdklfmfawdealamgltmgakgfigstynvnakganaiikaweandkeavmkltht
yndyvldliskglmqslkaimrlhgvdagytrkpfwryedeeikkhaefitdkylk

Sequence, based on observed residues (ATOM records): (download)

>d4n4pa_ c.1.10.0 (A:) automated matches {Mycoplasma synoviae [TaxId: 262723]}
mhnfdkfkglfpamvtpftkdgklhkagvkevvnflvekqkvdgiyitgstgeflllsfe
dkkevmklvaeanagrvtliaqigslnieetkelaklakelkydaisaitpyyynfsfne
thhyyeeiskaadipmliyylpvstdqfgklleiknvigskygatdlfaferlmskypdk
lfmfawdealamgltmgakgfigstynvnakganaiikaweandkeavmklthtyndyvl
dliskglmqslkaimrlhgvdagytrkpfwryedeeikkhaefitdkylk

SCOPe Domain Coordinates for d4n4pa_:

Click to download the PDB-style file with coordinates for d4n4pa_.
(The format of our PDB-style files is described here.)

Timeline for d4n4pa_: