Lineage for d1efga1 (1efg A:283-403)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 560975Superfamily b.43.3: Translation proteins [50447] (3 families) (S)
  5. 560976Family b.43.3.1: Elongation factors [50448] (9 proteins)
  6. 560994Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 560995Species Thermus thermophilus [TaxId:274] [50457] (6 PDB entries)
  8. 561000Domain d1efga1: 1efg A:283-403 [25711]
    Other proteins in same PDB: d1efga2, d1efga3, d1efga4
    complexed with gdp

Details for d1efga1

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution

SCOP Domain Sequences for d1efga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

SCOP Domain Coordinates for d1efga1:

Click to download the PDB-style file with coordinates for d1efga1.
(The format of our PDB-style files is described here.)

Timeline for d1efga1: