Lineage for d4mu8b_ (4mu8 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980919Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980923Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries)
    Uniprot P00044
  8. 1980931Domain d4mu8b_: 4mu8 B: [257108]
    automated match to d2bcnb_
    complexed with gol, hem, so4, tbu

Details for d4mu8b_

PDB Entry: 4mu8 (more details), 1.45 Å

PDB Description: crystal structure of an oxidized form of yeast iso-1-cytochrome c at ph 8.8
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d4mu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mu8b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d4mu8b_:

Click to download the PDB-style file with coordinates for d4mu8b_.
(The format of our PDB-style files is described here.)

Timeline for d4mu8b_: