SCOPe 2.05: Domain d4mrta2: 4mrt A:102-225

Lineage for d4mrta2 (4mrt A:102-225)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins)
   monomeric; tandem duplication of beta-alpha(3)-beta(2) motif

6. Protein automated matches [257101] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257102] (1 PDB entry)

8. Domain d4mrta2: 4mrt A:102-225 [257104]
   Other proteins in same PDB: d4mrtc_
   automated match to d1qr0a2
   complexed with coa, gol, mg, so4

Details for d4mrta2

PDB Entry: 4mrt, 2 Å

PDB Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein

PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfp

SCOPe Domain Sequences for d4mrta2:

Sequence; same for both SEQRES and ATOM records:

>d4mrta2 d.150.1.1 (A:102-225) automated matches {Bacillus subtilis [TaxId: 224308]}
qpigidiektkpisleiakrffskteysdllakdkdeqtdyfyhlwsmkesfikqegkgl
slpldsfsvrlhqdgqvsielpdshspcyiktyevdpgykmavcaahpdfpeditmvsye
ellr

Timeline for d4mrta2:

• d4mrta2 first appeared in SCOPe 2.04
  
• d4mrta2 appears in SCOPe 2.06
  
• d4mrta2 appears in the current release, SCOPe 2.08