![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins) monomeric; tandem duplication of beta-alpha(3)-beta(2) motif |
![]() | Protein automated matches [257101] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [257102] (1 PDB entry) |
![]() | Domain d4mrta1: 4mrt A:1-101 [257103] Other proteins in same PDB: d4mrtc_ automated match to d1qr0a1 complexed with coa, gol, mg, so4 |
PDB Entry: 4mrt (more details), 2 Å
SCOPe Domain Sequences for d4mrta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mrta1 d.150.1.1 (A:1-101) automated matches {Bacillus subtilis [TaxId: 224308]} mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds
Timeline for d4mrta1: