Lineage for d4mrta1 (4mrt A:1-101)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934100Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1934101Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1934102Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins)
    monomeric; tandem duplication of beta-alpha(3)-beta(2) motif
  6. 1934107Protein automated matches [257101] (1 species)
    not a true protein
  7. 1934108Species Bacillus subtilis [TaxId:224308] [257102] (1 PDB entry)
  8. 1934109Domain d4mrta1: 4mrt A:1-101 [257103]
    Other proteins in same PDB: d4mrtc_
    automated match to d1qr0a1
    complexed with coa, gol, mg, so4

Details for d4mrta1

PDB Entry: 4mrt (more details), 2 Å

PDB Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein
PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfp

SCOPe Domain Sequences for d4mrta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrta1 d.150.1.1 (A:1-101) automated matches {Bacillus subtilis [TaxId: 224308]}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds

SCOPe Domain Coordinates for d4mrta1:

Click to download the PDB-style file with coordinates for d4mrta1.
(The format of our PDB-style files is described here.)

Timeline for d4mrta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mrta2
View in 3D
Domains from other chains:
(mouse over for more information)
d4mrtc_