Lineage for d1elo_1 (1elo 283-399)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14697Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 14698Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries)
  8. 14702Domain d1elo_1: 1elo 283-399 [25710]
    Other proteins in same PDB: d1elo_2, d1elo_3, d1elo_4

Details for d1elo_1

PDB Entry: 1elo (more details), 2.85 Å

PDB Description: elongation factor g without nucleotide
PDB Compounds: ( :)

SCOP Domain Sequences for d1elo_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elo_1 b.43.3.1 (283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

SCOP Domain Coordinates for d1elo_1:

Click to download the PDB-style file with coordinates for d1elo_1.
(The format of our PDB-style files is described here.)

Timeline for d1elo_1: