Lineage for d4mned_ (4mne D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219307Protein Dual specificity mitogen-activated protein kinase kinase 1, Mek1 [118137] (1 species)
    OPK group (?); MAPKK subfamily; serine/threonine kinase
  7. 2219308Species Human (Homo sapiens) [TaxId:9606] [118138] (22 PDB entries)
    Uniprot Q02750 61-381
  8. 2219331Domain d4mned_: 4mne D: [257092]
    Other proteins in same PDB: d4mneb_, d4mnec_, d4mnef_, d4mneg_
    automated match to d1s9ja_
    complexed with 573, acp, cl, mg

Details for d4mned_

PDB Entry: 4mne (more details), 2.85 Å

PDB Description: Crystal structure of the BRAF:MEK1 complex
PDB Compounds: (D:) Dual specificity mitogen-activated protein kinase kinase 1

SCOPe Domain Sequences for d4mned_:

Sequence, based on SEQRES records: (download)

>d4mned_ d.144.1.7 (D:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
ddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhecnspy
ivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylrekhk
imhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthysvqsd
iwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssygmdsr
ppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsd
aeevdfagwlcstigln

Sequence, based on observed residues (ATOM records): (download)

>d4mned_ d.144.1.7 (D:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
ddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhecnspy
ivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylrekhk
imhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthysvqsd
iwsmglslvemavgrypipppdakelelmpmaifelldyivnepppklpsgvfslefqdf
vnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln

SCOPe Domain Coordinates for d4mned_:

Click to download the PDB-style file with coordinates for d4mned_.
(The format of our PDB-style files is described here.)

Timeline for d4mned_: