Lineage for d1fnma1 (1fnm A:283-403)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317183Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 1317184Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 1317189Domain d1fnma1: 1fnm A:283-403 [25709]
    Other proteins in same PDB: d1fnma2, d1fnma3, d1fnma4, d1fnma5
    complexed with gdp, mg

Details for d1fnma1

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1fnma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

SCOPe Domain Coordinates for d1fnma1:

Click to download the PDB-style file with coordinates for d1fnma1.
(The format of our PDB-style files is described here.)

Timeline for d1fnma1: