SCOPe 2.02: Domain d1fnma1: 1fnm A:283-403

Lineage for d1fnma1 (1fnm A:283-403)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (6 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)

8. Domain d1fnma1: 1fnm A:283-403 [25709]
   Other proteins in same PDB: d1fnma2, d1fnma3, d1fnma4, d1fnma5
   complexed with gdp, mg

Details for d1fnma1

PDB Entry: 1fnm, 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1fnma1:

Sequence; same for both SEQRES and ATOM records:

>d1fnma1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

Timeline for d1fnma1:

• d1fnma1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnma1 appears in SCOPe 2.01
  
• d1fnma1 appears in SCOPe 2.03
  
• d1fnma1 appears in the current release, SCOPe 2.08