SCOPe 2.01: Domain d2efga1: 2efg A:283-401

Lineage for d2efga1 (2efg A:283-401)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (6 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)

8. Domain d2efga1: 2efg A:283-401 [25708]
   Other proteins in same PDB: d2efga2, d2efga3, d2efga4
   complexed with gdp

Details for d2efga1

PDB Entry: 2efg, 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

PDB Compounds: (A:) protein (elongation factor g)

SCOPe Domain Sequences for d2efga1:

Sequence; same for both SEQRES and ATOM records:

>d2efga1 b.43.3.1 (A:283-401) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprviles

Timeline for d2efga1:

• d2efga1 first appeared (with stable ids) in SCOP 1.55
  
• d2efga1 appears in SCOP 1.75
  
• d2efga1 appears in SCOPe 2.02
  
• d2efga1 appears in the current release, SCOPe 2.08