SCOPe 2.05: Domain d4m8xb_: 4m8x B:

Lineage for d4m8xb_ (4m8x B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d4m8xb_: 4m8x B: [257075]
   automated match to d2rkfa_
   complexed with kgq; mutant

Details for d4m8xb_

PDB Entry: 4m8x, 2.05 Å

PDB Description: GS-8374, a Novel Phosphonate-Containing Inhibitor of HIV-1 Protease, Effectively Inhibits HIV PR Mutants with Amino Acid Insertions

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4m8xb_:

Sequence; same for both SEQRES and ATOM records:

>d4m8xb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrpfvtvkiagqlmealldtgaddtileemslpgrwtpkvvggiggfmkvrqyd
qilveicghkvigtvlvgptpaniigrnlltqigctlnf

Timeline for d4m8xb_:

• d4m8xb_ first appeared in SCOPe 2.04
  
• d4m8xb_ appears in SCOPe 2.06
  
• d4m8xb_ appears in the current release, SCOPe 2.08