Lineage for d4m3pa_ (4m3p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090074Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 2090075Family c.1.26.1: Homocysteine S-methyltransferase [82283] (3 protein domains)
    Pfam PF02574
  6. 2090105Protein automated matches [257071] (1 species)
    not a true protein
  7. 2090106Species Human (Homo sapiens) [TaxId:9606] [257072] (1 PDB entry)
  8. 2090107Domain d4m3pa_: 4m3p A: [257073]
    automated match to d1umyc_
    complexed with hcs, k, srt, zn

Details for d4m3pa_

PDB Entry: 4m3p (more details), 1.9 Å

PDB Description: Betaine-Homocysteine S-Methyltransferase from Homo sapiens complexed with Homocysteine
PDB Compounds: (A:) Betaine--homocysteine S-methyltransferase 1

SCOPe Domain Sequences for d4m3pa_:

Sequence, based on SEQRES records: (download)

>d4m3pa_ c.1.26.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
vmqtftfyasedklenrgnyvlekisgqevneaacdiarqvadegdalvaggvsqtpsyl
scksetevkkvflqqlevfmkknvdfliaeyfehveeavwavetliasgkpvaatmcigp
egdlhgvppgecavrlvkagasiigvnchfdptislktvklmkegleaaqlkahlmsqpl
ayhtpdcnkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhira
iaeelapergflppasekhgswgsgldmhtkpwvrararkeywenlriasgrpynpsmsk
pdgwgvtkgtaelmqqkeatteqqlkelfekq

Sequence, based on observed residues (ATOM records): (download)

>d4m3pa_ c.1.26.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
vmqtftfysgqevneaacdiarqvadegdalvaggvsqtpksetevkkvflqqlevfmkk
nvdfliaeyfehveeavwavetliasgkpvaatmcigpegdlhgvppgecavrlvkagas
iigvnchfdptislktvklmkegleaaqlkahlmsqplayhtpdcnkqgfidlpefpfgl
eprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflppasekhgsw
gsgldmhtkpwvrararkeywenlriasgrpynpsmskpdgwgvtkgtaelmqqkeatte
qqlkelfekq

SCOPe Domain Coordinates for d4m3pa_:

Click to download the PDB-style file with coordinates for d4m3pa_.
(The format of our PDB-style files is described here.)

Timeline for d4m3pa_: