SCOPe 2.07: Domain d4m3ga2: 4m3g A:97-214

Lineage for d4m3ga2 (4m3g A:97-214)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (45 PDB entries)
   Uniprot P96222 22-215

8. Domain d4m3ga2: 4m3g A:97-214 [257070]
   Other proteins in same PDB: d4m3ga1
   automated match to d1t56a2
   protein/DNA complex; complexed with 2g1

Details for d4m3ga2

PDB Entry: 4m3g, 2.3 Å

PDB Description: Rapid and efficient design of new inhibitors of Mycobacterium tuberculosis transcriptional repressor EthR using fragment growing, merging and linking approaches

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4m3ga2:

Sequence; same for both SEQRES and ATOM records:

>d4m3ga2 a.121.1.1 (A:97-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
tdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidae
rdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d4m3ga2:

• d4m3ga2 first appeared in SCOPe 2.04
  
• d4m3ga2 appears in SCOPe 2.06