Lineage for d4m3ga2 (4m3g A:97-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727859Protein Ethr repressor [109978] (2 species)
  7. 2727860Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. 2727917Domain d4m3ga2: 4m3g A:97-214 [257070]
    Other proteins in same PDB: d4m3ga1
    automated match to d1t56a2
    protein/DNA complex; complexed with 2g1

Details for d4m3ga2

PDB Entry: 4m3g (more details), 2.3 Å

PDB Description: Rapid and efficient design of new inhibitors of Mycobacterium tuberculosis transcriptional repressor EthR using fragment growing, merging and linking approaches
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4m3ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m3ga2 a.121.1.1 (A:97-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
tdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidae
rdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d4m3ga2:

Click to download the PDB-style file with coordinates for d4m3ga2.
(The format of our PDB-style files is described here.)

Timeline for d4m3ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m3ga1