Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries) |
Domain d1dara1: 1dar A:283-400 [25707] Other proteins in same PDB: d1dara2, d1dara3, d1dara4 complexed with gdp |
PDB Entry: 1dar (more details), 2.4 Å
SCOPe Domain Sequences for d1dara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dara1 b.43.3.1 (A:283-400) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvile
Timeline for d1dara1: