Lineage for d4m3ba1 (4m3b A:25-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692217Protein Ethr repressor [109651] (2 species)
  7. 2692218Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2692238Domain d4m3ba1: 4m3b A:25-92 [257061]
    Other proteins in same PDB: d4m3ba2
    automated match to d1t56a1
    protein/DNA complex; complexed with 2b2

Details for d4m3ba1

PDB Entry: 4m3b (more details), 2 Å

PDB Description: Rapid and efficient design of new inhibitors of Mycobacterium tuberculosis transcriptional repressor EthR using fragment growing, merging and linking approaches
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4m3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m3ba1 a.4.1.9 (A:25-92) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
relailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqad
malqtlae

SCOPe Domain Coordinates for d4m3ba1:

Click to download the PDB-style file with coordinates for d4m3ba1.
(The format of our PDB-style files is described here.)

Timeline for d4m3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m3ba2