Lineage for d1g7ca1 (1g7c A:241-334)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317170Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 1317171Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries)
  8. 1317174Domain d1g7ca1: 1g7c A:241-334 [25706]
    Other proteins in same PDB: d1g7ca2, d1g7ca3, d1g7cb_
    complexed with 5gp

Details for d1g7ca1

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1g7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOPe Domain Coordinates for d1g7ca1:

Click to download the PDB-style file with coordinates for d1g7ca1.
(The format of our PDB-style files is described here.)

Timeline for d1g7ca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g7cb_