SCOPe 2.08: Domain d4lvob2: 4lvo B:109-212

Lineage for d4lvob2 (4lvo B:109-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4lvob2: 4lvo B:109-212 [257058]
   Other proteins in same PDB: d4lvob1, d4lvoc1, d4lvoc2
   automated match to d4m43l2
   complexed with ca

Details for d4lvob2

PDB Entry: 4lvo, 2.26 Å

PDB Description: Crystal structure of PfSUB1-prodomain-NIMP.M7 Fab complex with added CaCl2

PDB Compounds: (B:) NIMP.M7 Fab light chain

SCOPe Domain Sequences for d4lvob2:

Sequence; same for both SEQRES and ATOM records:

>d4lvob2 b.1.1.2 (B:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4lvob2:

• d4lvob2 first appeared in SCOPe 2.04
  
• d4lvob2 appears in SCOPe 2.07