Lineage for d4lvnb2 (4lvn B:109-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752717Domain d4lvnb2: 4lvn B:109-212 [257056]
    Other proteins in same PDB: d4lvnb1, d4lvnc1, d4lvnc2
    automated match to d4m43l2
    complexed with ca, ni

Details for d4lvnb2

PDB Entry: 4lvn (more details), 2.25 Å

PDB Description: Crystal structure of PfSUB1-prodomain-NIMP.M7 Fab complex
PDB Compounds: (B:) NIMP.M7 Fab light chain

SCOPe Domain Sequences for d4lvnb2:

Sequence, based on SEQRES records: (download)

>d4lvnb2 b.1.1.2 (B:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d4lvnb2 b.1.1.2 (B:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltrhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4lvnb2:

Click to download the PDB-style file with coordinates for d4lvnb2.
(The format of our PDB-style files is described here.)

Timeline for d4lvnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lvnb1