Lineage for d4lnpa_ (4lnp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783451Domain d4lnpa_: 4lnp A: [257047]
    automated match to d1j3ta_

Details for d4lnpa_

PDB Entry: 4lnp (more details), 1.41 Å

PDB Description: The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
PDB Compounds: (A:) Sorbin and SH3 domain-containing protein 1

SCOPe Domain Sequences for d4lnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnpa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emrparakfdfkaqtlkelplqkgdivyiykqidqnwyegehhgrvgifprtyiellppa
e

SCOPe Domain Coordinates for d4lnpa_:

Click to download the PDB-style file with coordinates for d4lnpa_.
(The format of our PDB-style files is described here.)

Timeline for d4lnpa_: