SCOPe 2.04: Domain d4lmsb_: 4lms B:

Lineage for d4lmsb_ (4lms B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (15 species)
   not a true protein

7. Species Chroomonas sp. [TaxId:3029] [257042] (1 PDB entry)

8. Domain d4lmsb_: 4lms B: [257043]
   Other proteins in same PDB: d4lmsc_
   automated match to d1xg0d_
   complexed with cyc, dbv, m1v, p6g

Details for d4lmsb_

PDB Entry: 4lms, 1.35 Å

PDB Description: light harvesting complex pc645 from the cryptophyte chroomonas sp. ccmp270

PDB Compounds: (B:) cryptophyte phycocyanin (beta chain)

SCOPe Domain Sequences for d4lmsb_:

Sequence; same for both SEQRES and ATOM records:

>d4lmsb_ a.1.1.3 (B:) automated matches {Chroomonas sp. [TaxId: 3029]}
kaayvggadlqalkkfvsegnkrldavnaivsnascivsdavsgmicenpalispsgncy
tnrrmaaclrdaeiilryvsysllsgdssvledrclgglketyaslgvpaagnaravgim
katcvafinntsnqkklstpagdcsalasecagyfdkvtsal

Timeline for d4lmsb_:

• d4lmsb_ is new in SCOPe 2.04-stable
  
• d4lmsb_ appears in SCOPe 2.05
  
• d4lmsb_ appears in the current release, SCOPe 2.08