Lineage for d4lmba_ (4lmb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907935Species Microcystis aeruginosa [TaxId:267872] [257035] (2 PDB entries)
  8. 2907936Domain d4lmba_: 4lmb A: [257037]
    automated match to d4aecb_
    complexed with cys, plp

Details for d4lmba_

PDB Entry: 4lmb (more details), 1.91 Å

PDB Description: Crystal structure analysis of O-acetylserine sulfhydrylase CysK2 complexed with cystine from Microcystis aeruginosa 7806
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d4lmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmba_ c.79.1.0 (A:) automated matches {Microcystis aeruginosa [TaxId: 267872]}
mliarditqlvgrtplvqlnripvaegvkarivvklesmnpaasvkdrigvsmvedaeaa
glihpdktilveptsgntgialamvaaakgyrlvltmpetmslerramlkaygaqleltp
gsqgmegaitraeeiventpnayslqqfrnpanpkihrettaeeiwadtdglvdiviggv
gtggtitgiaetikprrpqfqaiavepsnspvlsggqpgphkiqgigagfipaifrpeli
deviivddteafayarrlarqegllsgisagaalwaaiqvgkrpenedklivmiqpsfge
rylstalfkd

SCOPe Domain Coordinates for d4lmba_:

Click to download the PDB-style file with coordinates for d4lmba_.
(The format of our PDB-style files is described here.)

Timeline for d4lmba_: