Lineage for d4liya_ (4liy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776950Species Human adenovirus type 3 [TaxId:45659] [63720] (2 PDB entries)
  8. 2776954Domain d4liya_: 4liy A: [257027]
    automated match to d3cnca_
    complexed with so4; mutant

Details for d4liya_

PDB Entry: 4liy (more details), 2.1 Å

PDB Description: Structure of the adenovirus 3 knob domain K217E and F224S mutant
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d4liya_:

Sequence, based on SEQRES records: (download)

>d4liya_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 3 [TaxId: 45659]}
nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv
sinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpnagthnen
yifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitsp
ftfsyiredd

Sequence, based on observed residues (ATOM records): (download)

>d4liya_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 3 [TaxId: 45659]}
nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv
sinvelyfdatghilpdssslktdleleykssargfmpsttaypfvlpnagthnenyifg
qcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfs
yiredd

SCOPe Domain Coordinates for d4liya_:

Click to download the PDB-style file with coordinates for d4liya_.
(The format of our PDB-style files is described here.)

Timeline for d4liya_: