Class g: Small proteins [56992] (92 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein automated matches [190676] (7 species) not a true protein |
Species Dendroaspis polylepis [TaxId:8620] [257019] (1 PDB entry) |
Domain d4lfta_: 4lft A: [257020] automated match to d1txba_ |
PDB Entry: 4lft (more details), 1.7 Å
SCOPe Domain Sequences for d4lfta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfta_ g.7.1.1 (A:) automated matches {Dendroaspis polylepis [TaxId: 8620]} rtcnktfsdqskicppgenicytktwcdafcsqrgkrvelgcaatcpkvkagveikccst dncn
Timeline for d4lfta_: